PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009327-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 374aa    MW: 41059.8 Da    PI: 6.2451
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009327-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.2e-072060438
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                   + C+ +++  + lfC+ ++ +lC +C  + H g       H+
  NNU_009327-RA 20 KPCDSCKSASALLFCRADSAFLCFNCDAKVH-GanklasrHE 60
                   68***************************99.4466666676 PP

2zf-B_box25.62.5e-0862107342
       zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                     ++C+ +e+ +++  C+ +   lC +C   +H+       H+++p+
  NNU_009327-RA  62 VWMCEVCEHAPASVTCKADAAVLCVTCDRDIHSAnplarrHERIPV 107
                    689*****************************66889999998885 PP

3CCT69.21.1e-23303346144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ 
  NNU_009327-RA 303 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRV 346
                    9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.7E-131764IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4521764IPR000315B-box-type zinc finger
PfamPF006431.0E-52061IPR000315B-box-type zinc finger
CDDcd000212.19E-82164No hitNo description
PROSITE profilePS5011910.93660107IPR000315B-box-type zinc finger
PfamPF006431.3E-662107IPR000315B-box-type zinc finger
CDDcd000213.09E-863107No hitNo description
SMARTSM003363.1E-1065107IPR000315B-box-type zinc finger
PfamPF062037.5E-18303345IPR010402CCT domain
PROSITE profilePS5101716.787303345IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MAIDEESGKG YPASWSLSAK PCDSCKSASA LLFCRADSAF LCFNCDAKVH GANKLASRHE  60
RVWMCEVCEH APASVTCKAD AAVLCVTCDR DIHSANPLAR RHERIPVVPF YESAASAMKS  120
NVANLLVPDG LLKSSDEDDD RNDKEEDNDT CREEAEAASW LLPNPNPPKL METPDLKSGD  180
YFFSDVDPYL DLDYGSSMET RYHHQNSANA DSVVPVHTKP PPPPLMNTSD RCFDMGFCRS  240
KPSYGYTTPT LSQSVSSSSL DVGVVPDGNS NAISDITNPF GRKGGVDAGG GNHGAPQLSG  300
MDREARVLRY REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRVEIDS EVDRIYSSTA  360
AFIADTGYGV VPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259762.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-112COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLF6GXA61e-148F6GXA6_VITVI; Putative uncharacterized protein
STRINGVIT_11s0052g01800.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-102CONSTANS-like 4